POLR2E MaxPab rabbit polyclonal antibody (D01)
  • POLR2E MaxPab rabbit polyclonal antibody (D01)

POLR2E MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005434-D01
POLR2E MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLR2E protein.
Información adicional
Size 100 uL
Gene Name POLR2E
Gene Alias RPABC1|RPB5|XAP4|hRPB25|hsRPB5
Gene Description polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR2E (NP_002686.2, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5434

Enviar uma mensagem


POLR2E MaxPab rabbit polyclonal antibody (D01)

POLR2E MaxPab rabbit polyclonal antibody (D01)