POLE purified MaxPab rabbit polyclonal antibody (D01P)
  • POLE purified MaxPab rabbit polyclonal antibody (D01P)

POLE purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005426-D01P
POLE purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POLE protein.
Información adicional
Size 100 ug
Gene Name POLE
Gene Alias DKFZp434F222|FLJ21434|POLE1
Gene Description polymerase (DNA directed), epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRDLDLCK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLE (AAH21559.1, 1 a.a. ~ 370 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5426

Enviar uma mensagem


POLE purified MaxPab rabbit polyclonal antibody (D01P)

POLE purified MaxPab rabbit polyclonal antibody (D01P)