UBL3 monoclonal antibody (M05), clone 3A8
  • UBL3 monoclonal antibody (M05), clone 3A8

UBL3 monoclonal antibody (M05), clone 3A8

Ref: AB-H00005412-M05
UBL3 monoclonal antibody (M05), clone 3A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBL3.
Información adicional
Size 100 ug
Gene Name UBL3
Gene Alias DKFZp434K151|FLJ32018|HCG-1|PNSC1
Gene Description ubiquitin-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBL3 (AAH59385, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5412
Clone Number 3A8
Iso type IgG1 Kappa

Enviar uma mensagem


UBL3 monoclonal antibody (M05), clone 3A8

UBL3 monoclonal antibody (M05), clone 3A8