PNN monoclonal antibody (M01), clone 2B4 View larger

Mouse monoclonal antibody raised against a partial recombinant PNN.

AB-H00005411-M01

New product

PNN monoclonal antibody (M01), clone 2B4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PNN
Gene Alias DRS|SDK3|memA|pinin
Gene Description pinin, desmosome associated protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNN (NP_002678, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5411
Clone Number 2B4
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PNN.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PNN.

Mouse monoclonal antibody raised against a partial recombinant PNN.