PNMT purified MaxPab rabbit polyclonal antibody (D01P)
  • PNMT purified MaxPab rabbit polyclonal antibody (D01P)

PNMT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005409-D01P
PNMT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PNMT protein.
Información adicional
Size 100 ug
Gene Name PNMT
Gene Alias MGC34570|PENT|PNMTase
Gene Description phenylethanolamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNMT (NP_002677.1, 1 a.a. ~ 282 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5409

Enviar uma mensagem


PNMT purified MaxPab rabbit polyclonal antibody (D01P)

PNMT purified MaxPab rabbit polyclonal antibody (D01P)