PNMT MaxPab mouse polyclonal antibody (B01P)
  • PNMT MaxPab mouse polyclonal antibody (B01P)

PNMT MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005409-B01P
PNMT MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PNMT protein.
Información adicional
Size 50 ug
Gene Name PNMT
Gene Alias MGC34570|PENT|PNMTase
Gene Description phenylethanolamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNMT (NP_002677.1, 1 a.a. ~ 282 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5409

Enviar uma mensagem


PNMT MaxPab mouse polyclonal antibody (B01P)

PNMT MaxPab mouse polyclonal antibody (B01P)