PLTP monoclonal antibody (M01), clone 2F3-G4
  • PLTP monoclonal antibody (M01), clone 2F3-G4

PLTP monoclonal antibody (M01), clone 2F3-G4

Ref: AB-H00005360-M01
PLTP monoclonal antibody (M01), clone 2F3-G4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PLTP.
Información adicional
Size 100 ug
Gene Name PLTP
Gene Alias HDLCQ9
Gene Description phospholipid transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq FPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLTP (AAH05045, 19 a.a. ~ 441 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5360
Clone Number 2F3-G4
Iso type IgG1 kappa

Enviar uma mensagem


PLTP monoclonal antibody (M01), clone 2F3-G4

PLTP monoclonal antibody (M01), clone 2F3-G4