PLTP MaxPab mouse polyclonal antibody (B01P)
  • PLTP MaxPab mouse polyclonal antibody (B01P)

PLTP MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005360-B01P
PLTP MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLTP protein.
Información adicional
Size 50 ug
Gene Name PLTP
Gene Alias HDLCQ9
Gene Description phospholipid transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLTP (AAH19898, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5360

Enviar uma mensagem


PLTP MaxPab mouse polyclonal antibody (B01P)

PLTP MaxPab mouse polyclonal antibody (B01P)