PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)

PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005359-D01P
PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLSCR1 protein.
Información adicional
Size 100 ug
Gene Name PLSCR1
Gene Alias MMTRA1B
Gene Description phospholipid scramblase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLSCR1 (NP_066928.1, 1 a.a. ~ 318 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5359

Enviar uma mensagem


PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)

PLSCR1 purified MaxPab rabbit polyclonal antibody (D01P)