PLS1 monoclonal antibody (M04), clone 3G10
  • PLS1 monoclonal antibody (M04), clone 3G10

PLS1 monoclonal antibody (M04), clone 3G10

Ref: AB-H00005357-M04
PLS1 monoclonal antibody (M04), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLS1.
Información adicional
Size 100 ug
Gene Name PLS1
Gene Alias I-PLASTIN
Gene Description plastin 1 (I isoform)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLS1 (NP_002661.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5357
Clone Number 3G10
Iso type IgG2b Kappa

Enviar uma mensagem


PLS1 monoclonal antibody (M04), clone 3G10

PLS1 monoclonal antibody (M04), clone 3G10