PLP2 monoclonal antibody (M01), clone 2G7
  • PLP2 monoclonal antibody (M01), clone 2G7

PLP2 monoclonal antibody (M01), clone 2G7

Ref: AB-H00005355-M01
PLP2 monoclonal antibody (M01), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PLP2.
Información adicional
Size 100 ug
Gene Name PLP2
Gene Alias A4|A4-LSB|MGC126187
Gene Description proteolipid protein 2 (colonic epithelium-enriched)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLP2 (NP_002659.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5355
Clone Number 2G7
Iso type IgG1 Kappa

Enviar uma mensagem


PLP2 monoclonal antibody (M01), clone 2G7

PLP2 monoclonal antibody (M01), clone 2G7