PLK1 monoclonal antibody (M02), clone 3F10
  • PLK1 monoclonal antibody (M02), clone 3F10

PLK1 monoclonal antibody (M02), clone 3F10

Ref: AB-H00005347-M02
PLK1 monoclonal antibody (M02), clone 3F10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PLK1.
Información adicional
Size 100 ug
Gene Name PLK1
Gene Alias PLK|STPK13
Gene Description polo-like kinase 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLK1 (AAH02369, 1 a.a. ~ 603 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5347
Clone Number 3F10
Iso type IgG2a Kappa

Enviar uma mensagem


PLK1 monoclonal antibody (M02), clone 3F10

PLK1 monoclonal antibody (M02), clone 3F10