PLK1 purified MaxPab mouse polyclonal antibody (B01P)
  • PLK1 purified MaxPab mouse polyclonal antibody (B01P)

PLK1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005347-B01P
PLK1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLK1 protein.
Información adicional
Size 50 ug
Gene Name PLK1
Gene Alias PLK|STPK13
Gene Description polo-like kinase 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLK1 (NP_005021.2, 1 a.a. ~ 603 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5347

Enviar uma mensagem


PLK1 purified MaxPab mouse polyclonal antibody (B01P)

PLK1 purified MaxPab mouse polyclonal antibody (B01P)