PLEK purified MaxPab rabbit polyclonal antibody (D01P)
  • PLEK purified MaxPab rabbit polyclonal antibody (D01P)

PLEK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005341-D01P
PLEK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLEK protein.
Información adicional
Size 100 ug
Gene Name PLEK
Gene Alias FLJ27168|P47
Gene Description pleckstrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEK (NP_002655.1, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5341

Enviar uma mensagem


PLEK purified MaxPab rabbit polyclonal antibody (D01P)

PLEK purified MaxPab rabbit polyclonal antibody (D01P)