PLEK polyclonal antibody (A01)
  • PLEK polyclonal antibody (A01)

PLEK polyclonal antibody (A01)

Ref: AB-H00005341-A01
PLEK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLEK.
Información adicional
Size 50 uL
Gene Name PLEK
Gene Alias FLJ27168|P47
Gene Description pleckstrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEK (AAH18549, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5341

Enviar uma mensagem


PLEK polyclonal antibody (A01)

PLEK polyclonal antibody (A01)