PLG monoclonal antibody (M01), clone 2A10
  • PLG monoclonal antibody (M01), clone 2A10

PLG monoclonal antibody (M01), clone 2A10

Ref: AB-H00005340-M01
PLG monoclonal antibody (M01), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLG.
Información adicional
Size 100 ug
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLG (AAH60513, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5340
Clone Number 2A10
Iso type IgG1 Kappa

Enviar uma mensagem


PLG monoclonal antibody (M01), clone 2A10

PLG monoclonal antibody (M01), clone 2A10