PLG monoclonal antibody (M01), clone 2A10 View larger

Mouse monoclonal antibody raised against a partial recombinant PLG.

AB-H00005340-M01

New product

PLG monoclonal antibody (M01), clone 2A10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLG (AAH60513, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5340
Clone Number 2A10
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PLG.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PLG.

Mouse monoclonal antibody raised against a partial recombinant PLG.