PLD2 monoclonal antibody (M01), clone 1C5
  • PLD2 monoclonal antibody (M01), clone 1C5

PLD2 monoclonal antibody (M01), clone 1C5

Ref: AB-H00005338-M01
PLD2 monoclonal antibody (M01), clone 1C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLD2.
Información adicional
Size 100 ug
Gene Name PLD2
Gene Alias -
Gene Description phospholipase D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5338
Clone Number 1C5
Iso type IgG2a Kappa

Enviar uma mensagem


PLD2 monoclonal antibody (M01), clone 1C5

PLD2 monoclonal antibody (M01), clone 1C5