PLD2 polyclonal antibody (A01)
  • PLD2 polyclonal antibody (A01)

PLD2 polyclonal antibody (A01)

Ref: AB-H00005338-A01
PLD2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLD2.
Información adicional
Size 50 uL
Gene Name PLD2
Gene Alias -
Gene Description phospholipase D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5338

Enviar uma mensagem


PLD2 polyclonal antibody (A01)

PLD2 polyclonal antibody (A01)