PLD1 monoclonal antibody (M02), clone 10H2
  • PLD1 monoclonal antibody (M02), clone 10H2

PLD1 monoclonal antibody (M02), clone 10H2

Ref: AB-H00005337-M02
PLD1 monoclonal antibody (M02), clone 10H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLD1.
Información adicional
Size 100 ug
Gene Name PLD1
Gene Alias -
Gene Description phospholipase D1, phosphatidylcholine-specific
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5337
Clone Number 10H2
Iso type IgG1 Kappa

Enviar uma mensagem


PLD1 monoclonal antibody (M02), clone 10H2

PLD1 monoclonal antibody (M02), clone 10H2