PLCG2 MaxPab rabbit polyclonal antibody (D01)
  • PLCG2 MaxPab rabbit polyclonal antibody (D01)

PLCG2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005336-D01
PLCG2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLCG2 protein.
Información adicional
Size 100 uL
Gene Name PLCG2
Gene Alias -
Gene Description phospholipase C, gamma 2 (phosphatidylinositol-specific)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLCG2 (AAH07565.1, 1 a.a. ~ 1265 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5336

Enviar uma mensagem


PLCG2 MaxPab rabbit polyclonal antibody (D01)

PLCG2 MaxPab rabbit polyclonal antibody (D01)