PLCG1 polyclonal antibody (A01)
  • PLCG1 polyclonal antibody (A01)

PLCG1 polyclonal antibody (A01)

Ref: AB-H00005335-A01
PLCG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLCG1.
Información adicional
Size 50 uL
Gene Name PLCG1
Gene Alias PLC-II|PLC1|PLC148|PLCgamma1
Gene Description phospholipase C, gamma 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5335

Enviar uma mensagem


PLCG1 polyclonal antibody (A01)

PLCG1 polyclonal antibody (A01)