PLAUR polyclonal antibody (A02)
  • PLAUR polyclonal antibody (A02)

PLAUR polyclonal antibody (A02)

Ref: AB-H00005329-A02
PLAUR polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLAUR.
Información adicional
Size 50 uL
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAUR (NP_001005377, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5329

Enviar uma mensagem


PLAUR polyclonal antibody (A02)

PLAUR polyclonal antibody (A02)