PLAUR polyclonal antibody (A01)
  • PLAUR polyclonal antibody (A01)

PLAUR polyclonal antibody (A01)

Ref: AB-H00005329-A01
PLAUR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLAUR.
Información adicional
Size 50 uL
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAUR (NP_002650, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5329

Enviar uma mensagem


PLAUR polyclonal antibody (A01)

PLAUR polyclonal antibody (A01)