PLAT MaxPab rabbit polyclonal antibody (D01)
  • PLAT MaxPab rabbit polyclonal antibody (D01)

PLAT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005327-D01
PLAT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLAT protein.
Información adicional
Size 100 uL
Gene Name PLAT
Gene Alias DKFZp686I03148|T-PA|TPA
Gene Description plasminogen activator, tissue
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLAT (NP_000921.1, 1 a.a. ~ 562 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5327

Enviar uma mensagem


PLAT MaxPab rabbit polyclonal antibody (D01)

PLAT MaxPab rabbit polyclonal antibody (D01)