PLAGL2 polyclonal antibody (A01)
  • PLAGL2 polyclonal antibody (A01)

PLAGL2 polyclonal antibody (A01)

Ref: AB-H00005326-A01
PLAGL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLAGL2.
Información adicional
Size 50 uL
Gene Name PLAGL2
Gene Alias FLJ23283
Gene Description pleiomorphic adenoma gene-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAGL2 (NP_002648, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5326

Enviar uma mensagem


PLAGL2 polyclonal antibody (A01)

PLAGL2 polyclonal antibody (A01)