PLAG1 monoclonal antibody (M02), clone 3B7
  • PLAG1 monoclonal antibody (M02), clone 3B7

PLAG1 monoclonal antibody (M02), clone 3B7

Ref: AB-H00005324-M02
PLAG1 monoclonal antibody (M02), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLAG1.
Información adicional
Size 50 ug
Gene Name PLAG1
Gene Alias PSA|SGPA
Gene Description pleiomorphic adenoma gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5324
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


PLAG1 monoclonal antibody (M02), clone 3B7

PLAG1 monoclonal antibody (M02), clone 3B7