PLAG1 polyclonal antibody (A01)
  • PLAG1 polyclonal antibody (A01)

PLAG1 polyclonal antibody (A01)

Ref: AB-H00005324-A01
PLAG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLAG1.
Información adicional
Size 50 uL
Gene Name PLAG1
Gene Alias PSA|SGPA
Gene Description pleiomorphic adenoma gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5324

Enviar uma mensagem


PLAG1 polyclonal antibody (A01)

PLAG1 polyclonal antibody (A01)