PLA2G1B monoclonal antibody (M01), clone 1B3
  • PLA2G1B monoclonal antibody (M01), clone 1B3

PLA2G1B monoclonal antibody (M01), clone 1B3

Ref: AB-H00005319-M01
PLA2G1B monoclonal antibody (M01), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PLA2G1B.
Información adicional
Size 100 ug
Gene Name PLA2G1B
Gene Alias MGC119834|MGC119835|PLA2|PLA2A|PPLA2
Gene Description phospholipase A2, group IB (pancreas)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLA2G1B (AAH05386, 17 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5319
Clone Number 1B3
Iso type IgG2a Kappa

Enviar uma mensagem


PLA2G1B monoclonal antibody (M01), clone 1B3

PLA2G1B monoclonal antibody (M01), clone 1B3