PKNOX1 monoclonal antibody (M03), clone 4H4
  • PKNOX1 monoclonal antibody (M03), clone 4H4

PKNOX1 monoclonal antibody (M03), clone 4H4

Ref: AB-H00005316-M03
PKNOX1 monoclonal antibody (M03), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PKNOX1.
Información adicional
Size 100 ug
Gene Name PKNOX1
Gene Alias PREP1|pkonx1c
Gene Description PBX/knotted 1 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKNOX1 (NP_004562, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5316
Clone Number 4H4
Iso type IgG2a Kappa

Enviar uma mensagem


PKNOX1 monoclonal antibody (M03), clone 4H4

PKNOX1 monoclonal antibody (M03), clone 4H4