PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)
  • PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)

PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005316-B02P
PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PKNOX1 protein.
Información adicional
Size 50 ug
Gene Name PKNOX1
Gene Alias PREP1|pkonx1c
Gene Description PBX/knotted 1 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAITGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQLQLNQDLSILHQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PKNOX1 (NP_004562.2, 1 a.a. ~ 436 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5316

Enviar uma mensagem


PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)

PKNOX1 purified MaxPab mouse polyclonal antibody (B02P)