PITX2 polyclonal antibody (A03)
  • PITX2 polyclonal antibody (A03)

PITX2 polyclonal antibody (A03)

Ref: AB-H00005308-A03
PITX2 polyclonal antibody (A03)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PITX2.
Información adicional
Size 50 uL
Gene Name PITX2
Gene Alias ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|MGC111022|MGC20144|Otlx2|PTX2|RGS|RIEG|RIEG1|RS
Gene Description paired-like homeodomain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PITX2 (NP_700476, 189 a.a. ~ 270 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5308

Enviar uma mensagem


PITX2 polyclonal antibody (A03)

PITX2 polyclonal antibody (A03)