PITX1 monoclonal antibody (M01), clone 5G4
  • PITX1 monoclonal antibody (M01), clone 5G4

PITX1 monoclonal antibody (M01), clone 5G4

Ref: AB-H00005307-M01
PITX1 monoclonal antibody (M01), clone 5G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PITX1.
Información adicional
Size 100 ug
Gene Name PITX1
Gene Alias BFT|POTX|PTX1
Gene Description paired-like homeodomain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5307
Clone Number 5G4
Iso type IgG2a Kappa

Enviar uma mensagem


PITX1 monoclonal antibody (M01), clone 5G4

PITX1 monoclonal antibody (M01), clone 5G4