PITPNA monoclonal antibody (M01), clone 4G10
  • PITPNA monoclonal antibody (M01), clone 4G10

PITPNA monoclonal antibody (M01), clone 4G10

Ref: AB-H00005306-M01
PITPNA monoclonal antibody (M01), clone 4G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PITPNA.
Información adicional
Size 100 ug
Gene Name PITPNA
Gene Alias MGC99649|PITPN|VIB1A
Gene Description phosphatidylinositol transfer protein, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PITPNA (NP_006215.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5306
Clone Number 4G10
Iso type IgG2a Kappa

Enviar uma mensagem


PITPNA monoclonal antibody (M01), clone 4G10

PITPNA monoclonal antibody (M01), clone 4G10