PIN4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PIN4 purified MaxPab rabbit polyclonal antibody (D01P)

PIN4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005303-D01P
PIN4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PIN4 protein.
Información adicional
Size 100 ug
Gene Name PIN4
Gene Alias EPVH|MGC138486|PAR14|PAR17
Gene Description protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIN4 (NP_006214.2, 1 a.a. ~ 156 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5303

Enviar uma mensagem


PIN4 purified MaxPab rabbit polyclonal antibody (D01P)

PIN4 purified MaxPab rabbit polyclonal antibody (D01P)