PIN4 polyclonal antibody (A01)
  • PIN4 polyclonal antibody (A01)

PIN4 polyclonal antibody (A01)

Ref: AB-H00005303-A01
PIN4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIN4.
Información adicional
Size 50 uL
Gene Name PIN4
Gene Alias EPVH|MGC138486|PAR14|PAR17
Gene Description protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIN4 (NP_006214, 61 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5303

Enviar uma mensagem


PIN4 polyclonal antibody (A01)

PIN4 polyclonal antibody (A01)