PIN1 monoclonal antibody (M02), clone 5A8
  • PIN1 monoclonal antibody (M02), clone 5A8

PIN1 monoclonal antibody (M02), clone 5A8

Ref: AB-H00005300-M02
PIN1 monoclonal antibody (M02), clone 5A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIN1.
Información adicional
Size 100 ug
Gene Name PIN1
Gene Alias DOD|UBL5
Gene Description peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIN1 (AAH02899, 64 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5300
Clone Number 5A8
Iso type IgG1 kappa

Enviar uma mensagem


PIN1 monoclonal antibody (M02), clone 5A8

PIN1 monoclonal antibody (M02), clone 5A8