PIK4CB monoclonal antibody (M02), clone 3B1
  • PIK4CB monoclonal antibody (M02), clone 3B1

PIK4CB monoclonal antibody (M02), clone 3B1

Ref: AB-H00005298-M02
PIK4CB monoclonal antibody (M02), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK4CB.
Información adicional
Size 100 ug
Gene Name PI4KB
Gene Alias PI4K-BETA|PI4KIIIbeta|PI4Kbeta|PIK4CB|pi4K92
Gene Description phosphatidylinositol 4-kinase, catalytic, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK4CB (NP_002642.1, 731 a.a. ~ 828 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5298
Clone Number 3B1
Iso type IgG2b Kappa

Enviar uma mensagem


PIK4CB monoclonal antibody (M02), clone 3B1

PIK4CB monoclonal antibody (M02), clone 3B1