PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)

PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005295-D01P
PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PIK3R1 protein.
Información adicional
Size 100 ug
Gene Name PIK3R1
Gene Alias GRB1|p85|p85-ALPHA
Gene Description phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MHNLQTLPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIK3R1 (ENSP00000323512, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5295

Enviar uma mensagem


PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)

PIK3R1 purified MaxPab rabbit polyclonal antibody (D01P)