View larger
Mouse monoclonal antibody raised against a partial recombinant PIK3CG.
AB-H00005294-M02
New product
PIK3CG monoclonal antibody (M02), clone 2G3
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PIK3CG |
| Gene Alias | PI3CG|PI3K|PI3Kgamma|PIK3 |
| Gene Description | phosphoinositide-3-kinase, catalytic, gamma polypeptide |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,PLA-Ce,IF |
| Immunogen Prot. Seq | MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PIK3CG (AAH35683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5294 |
| Clone Number | 2G3 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant PIK3CG.