PIK3CG monoclonal antibody (M02), clone 2G3
  • PIK3CG monoclonal antibody (M02), clone 2G3

PIK3CG monoclonal antibody (M02), clone 2G3

Ref: AB-H00005294-M02
PIK3CG monoclonal antibody (M02), clone 2G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK3CG.
Información adicional
Size 100 ug
Gene Name PIK3CG
Gene Alias PI3CG|PI3K|PI3Kgamma|PIK3
Gene Description phosphoinositide-3-kinase, catalytic, gamma polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3CG (AAH35683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5294
Clone Number 2G3
Iso type IgG2a Kappa

Enviar uma mensagem


PIK3CG monoclonal antibody (M02), clone 2G3

PIK3CG monoclonal antibody (M02), clone 2G3