PIK3CB monoclonal antibody (M01), clone 4H2
  • PIK3CB monoclonal antibody (M01), clone 4H2

PIK3CB monoclonal antibody (M01), clone 4H2

Ref: AB-H00005291-M01
PIK3CB monoclonal antibody (M01), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK3CB.
Información adicional
Size 100 ug
Gene Name PIK3CB
Gene Alias DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA
Gene Description phosphoinositide-3-kinase, catalytic, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,PLA-Ce
Immunogen Prot. Seq EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5291
Clone Number 4H2
Iso type IgG2a Kappa

Enviar uma mensagem


PIK3CB monoclonal antibody (M01), clone 4H2

PIK3CB monoclonal antibody (M01), clone 4H2