PIK3CB polyclonal antibody (A01)
  • PIK3CB polyclonal antibody (A01)

PIK3CB polyclonal antibody (A01)

Ref: AB-H00005291-A01
PIK3CB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIK3CB.
Información adicional
Size 50 uL
Gene Name PIK3CB
Gene Alias DKFZp779K1237|MGC133043|PI3K|PI3KCB|PI3Kbeta|PIK3C1|p110-BETA
Gene Description phosphoinositide-3-kinase, catalytic, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5291

Enviar uma mensagem


PIK3CB polyclonal antibody (A01)

PIK3CB polyclonal antibody (A01)