PIK3C2A polyclonal antibody (A01)
  • PIK3C2A polyclonal antibody (A01)

PIK3C2A polyclonal antibody (A01)

Ref: AB-H00005286-A01
PIK3C2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIK3C2A.
Información adicional
Size 50 uL
Gene Name PIK3C2A
Gene Alias CPK|DKFZp686L193|MGC142218|PI3-K-C2(ALPHA)|PI3-K-C2A
Gene Description phosphoinositide-3-kinase, class 2, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3C2A (NP_002636, 1577 a.a. ~ 1686 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5286

Enviar uma mensagem


PIK3C2A polyclonal antibody (A01)

PIK3C2A polyclonal antibody (A01)