PIGR monoclonal antibody (M01), clone 2G5
  • PIGR monoclonal antibody (M01), clone 2G5

PIGR monoclonal antibody (M01), clone 2G5

Ref: AB-H00005284-M01
PIGR monoclonal antibody (M01), clone 2G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGR.
Información adicional
Size 100 ug
Gene Name PIGR
Gene Alias FLJ22667|MGC125361|MGC125362
Gene Description polymeric immunoglobulin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGR (NP_002635, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5284
Clone Number 2G5
Iso type IgG2a Kappa

Enviar uma mensagem


PIGR monoclonal antibody (M01), clone 2G5

PIGR monoclonal antibody (M01), clone 2G5