PIGC monoclonal antibody (M01), clone 1G2
  • PIGC monoclonal antibody (M01), clone 1G2

PIGC monoclonal antibody (M01), clone 1G2

Ref: AB-H00005279-M01
PIGC monoclonal antibody (M01), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGC.
Información adicional
Size 100 ug
Gene Name PIGC
Gene Alias GPI2|MGC2049
Gene Description phosphatidylinositol glycan anchor biosynthesis, class C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGC (NP_002633, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5279
Clone Number 1G2
Iso type IgG2a Kappa

Enviar uma mensagem


PIGC monoclonal antibody (M01), clone 1G2

PIGC monoclonal antibody (M01), clone 1G2