SERPINB10 monoclonal antibody (M09), clone 2B8
  • SERPINB10 monoclonal antibody (M09), clone 2B8

SERPINB10 monoclonal antibody (M09), clone 2B8

Ref: AB-H00005273-M09
SERPINB10 monoclonal antibody (M09), clone 2B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SERPINB10.
Información adicional
Size 100 ug
Gene Name SERPINB10
Gene Alias PI10|bomapin
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq AKGTTAAQMAQVLQFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQPVNFVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB10 (NP_005015.1, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5273
Clone Number 2B8
Iso type IgG2b Lambda

Enviar uma mensagem


SERPINB10 monoclonal antibody (M09), clone 2B8

SERPINB10 monoclonal antibody (M09), clone 2B8