SERPINB9 polyclonal antibody (A01)
  • SERPINB9 polyclonal antibody (A01)

SERPINB9 polyclonal antibody (A01)

Ref: AB-H00005272-A01
SERPINB9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SERPINB9.
Información adicional
Size 50 uL
Gene Name SERPINB9
Gene Alias CAP-3|CAP3|PI9
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB9 (NP_004146, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5272

Enviar uma mensagem


SERPINB9 polyclonal antibody (A01)

SERPINB9 polyclonal antibody (A01)