SERPINB8 monoclonal antibody (M01A), clone 1D10
  • SERPINB8 monoclonal antibody (M01A), clone 1D10

SERPINB8 monoclonal antibody (M01A), clone 1D10

Ref: AB-H00005271-M01A
SERPINB8 monoclonal antibody (M01A), clone 1D10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SERPINB8.
Información adicional
Size 200 uL
Gene Name SERPINB8
Gene Alias CAP2|PI8
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB8 (AAH34528, 1 a.a. ~ 242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5271
Clone Number 1D10
Iso type IgM Kappa

Enviar uma mensagem


SERPINB8 monoclonal antibody (M01A), clone 1D10

SERPINB8 monoclonal antibody (M01A), clone 1D10