SERPINB6 MaxPab mouse polyclonal antibody (B01)
  • SERPINB6 MaxPab mouse polyclonal antibody (B01)

SERPINB6 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00005269-B01
SERPINB6 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINB6 protein.
Información adicional
Size 50 uL
Gene Name SERPINB6
Gene Alias CAP|DKFZp686I04222|MGC111370|MSTP057|PI6|PTI|SPI3
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRVANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINB6 (AAH01394.1, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5269

Enviar uma mensagem


SERPINB6 MaxPab mouse polyclonal antibody (B01)

SERPINB6 MaxPab mouse polyclonal antibody (B01)