PI3 monoclonal antibody (M02), clone 2G20
  • PI3 monoclonal antibody (M02), clone 2G20

PI3 monoclonal antibody (M02), clone 2G20

Ref: AB-H00005266-M02
PI3 monoclonal antibody (M02), clone 2G20

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PI3.
Información adicional
Size 100 ug
Gene Name PI3
Gene Alias ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin
Gene Description peptidase inhibitor 3, skin-derived
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PI3 (AAH10952, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5266
Clone Number 2G20
Iso type IgG2a Kappa

Enviar uma mensagem


PI3 monoclonal antibody (M02), clone 2G20

PI3 monoclonal antibody (M02), clone 2G20