View larger
Mouse monoclonal antibody raised against a full length recombinant PI3.
AB-H00005266-M01
New product
PI3 monoclonal antibody (M01), clone 3G9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PI3 |
| Gene Alias | ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin |
| Gene Description | peptidase inhibitor 3, skin-derived |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PI3 (AAH10952, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5266 |
| Clone Number | 3G9 |
| Iso type | IgG1 kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant PI3.